Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLP-1 (9-36) amide

Major metabolite of glucagon like peptide GLP-1 (7-36) amide; Peptides.

Product Specifications

Product Name Alternative

161748-29-4, EGTFTSDVSSYLEGQAAKEFIAWLVKGRGH040, GLP-1 (9-36) amide, GLP-1 receptor, Glucagon-like peptide-1 (9-36) amide, Glucagon-like peptide-1- (9-36) amide, H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, glucoregulatory, insulinotropic , metabolite

Field of Research

Metabolism Research

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in dilute acid

Molecular Weight

3089.4 Da

Storage Conditions

Store dry, frozen and desiccated

Notes

For research use only.

AA Sequence

H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Annexin A1 (ANXA1)
RPU40293-01 50 µg

Recombinant Rat Annexin A1 (ANXA1)

Sign In for Pricing
View Details
Recombinant Rat Annexin A1 (ANXA1)
RPU40293-02 100 µg

Recombinant Rat Annexin A1 (ANXA1)

Sign In for Pricing
View Details
Recombinant Rat Annexin A1 (ANXA1)
RPU40293-03 1 mg

Recombinant Rat Annexin A1 (ANXA1)

Sign In for Pricing
View Details
Mouse Coiled coil domain containing protein 136 (CCDC136) ELISA kit
GTR10414661 96 Well

Mouse Coiled coil domain containing protein 136 (CCDC136) ELISA kit

Sign In for Pricing
View Details
I7500-PR-Roll-25 Desktop Printer Accessories
177737 1 Box (1 Piece (s) x 1 Piece)

I7500-PR-Roll-25 Desktop Printer Accessories

Sign In for Pricing
View Details
CCDC62 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-13807R-PE-Cy5.5 100 µL

CCDC62 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details