GLP-1 (9-36) amide
Major metabolite of glucagon like peptide GLP-1 (7-36) amide; Peptides.
Product Specifications
Product Name Alternative
161748-29-4, EGTFTSDVSSYLEGQAAKEFIAWLVKGRGH040, GLP-1 (9-36) amide, GLP-1 receptor, Glucagon-like peptide-1 (9-36) amide, Glucagon-like peptide-1- (9-36) amide, H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, glucoregulatory, insulinotropic , metabolite
Field of Research
Metabolism Research
Purity
> 95% by HPLC
Form
Freeze dried solid
Solubility
Soluble in dilute acid
Molecular Weight
3089.4 Da
Storage Conditions
Store dry, frozen and desiccated
Notes
For research use only.
AA Sequence
H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
More Discoveries
Explore Other Products
Browse additional items from our catalog
035952-HRP 200 µL
GCDFP-15, CT (PIP, GCDFP15, GPIP4, Prolactin-inducible protein, Gross cystic disease fluid protein 15, Prolactin-induced protein, Secretory actin-binding protein, gp17) (Azide free) (HRP)
Sign In for Pricing
View Details