Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KP1

Disrupts TGF-β/TβR2 interaction; Peptides.

Product Specifications

Product Name Alternative

FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG, KP-1, , KP1, KP1 (human), Klotho-derived peptide 1PP290

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in water to 1 mg/ml

Molecular Weight

3228.48 Da

Storage Conditions

Store dry, frozen and in the dark

Notes

For research use only.

AA Sequence

H-Phe-Gln-Gly-Thr-Phe-Pro-Asp-Gly-Phe-Leu-Trp-Ala-Val-Gly-Ser-Ala-Ala-Tyr-Gln-Thr-Glu-Gly-Gly-Trp-Gln-Gln-His-Gly-Lys-Gly-OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pou4f3 shRNA (UAS) - Lentiviral mouse Pou4f3 shRNA (UAS, iRFP) (100)
GTR15157743 1 Vial

Lentiviral mouse Pou4f3 shRNA (UAS) - Lentiviral mouse Pou4f3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
DEFB130 3'UTR GFP Stable Cell Line
TU055797 1.0 mL

DEFB130 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SC 19886
T69705-01 25 mg

SC 19886

Sign In for Pricing
View Details
SC 19886
T69705-02 50 mg

SC 19886

Sign In for Pricing
View Details
SC 19886
T69705-03 100 mg

SC 19886

Sign In for Pricing
View Details
Human PDCD4 Recombinant Protein
PROTQ53EL6-01 10 µg

Human PDCD4 Recombinant Protein

Sign In for Pricing
View Details