Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y (human, rat)

Endogenous neuropeptide Y receptor agonist; Peptides.

Product Specifications

Product Name Alternative

90880-35-6GH060, H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, NPY, Neuropeptide Y, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, blood pressure regulation, endogenous neuropeptide

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in dilute acid

Molecular Weight

4271.7 Da

Storage Conditions

Store in the dark, frozen and desiccated

Notes

For research use only.

AA Sequence

H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red Conjugated Arachis hypogaea Lectin (Peanut) -PNA-
T-2301-2 2 mg

Texas Red Conjugated Arachis hypogaea Lectin (Peanut) -PNA-

Sign In for Pricing
View Details
Frozen Tissue Sections, Ileum
CS643972 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
2,2-Difluoroethylamine-13C2 Hydrochloride
TRC-D019348-10MG 10 mg

2,2-Difluoroethylamine-13C2 Hydrochloride

Sign In for Pricing
View Details
3,6,9-Trioxaeicos-19-en-1-ol
TRC-T804500-25MG 25 mg

3,6,9-Trioxaeicos-19-en-1-ol

Sign In for Pricing
View Details
ANXA4 Rabbit Monoclonal Antibody [Clone ID: 24GB4715]
TA424508 100 µL

ANXA4 Rabbit Monoclonal Antibody [Clone ID: 24GB4715]

Sign In for Pricing
View Details
Weigh Boats
B6503W 250 Sheets/Pack

Weigh Boats

Sign In for Pricing
View Details