Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y (human, rat)

Endogenous neuropeptide Y receptor agonist; Peptides.

Product Specifications

Product Name Alternative

90880-35-6GH060, H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, NPY, Neuropeptide Y, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, blood pressure regulation, endogenous neuropeptide

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in dilute acid

Molecular Weight

4271.7 Da

Storage Conditions

Store in the dark, frozen and desiccated

Notes

For research use only.

AA Sequence

H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lung Specific Antigen (LSA120), CF647 conjugate, 0.1mg/mL
BNC470120-500 1x 500 µL

Lung Specific Antigen (LSA120), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IKBKG Polyclonal Antibody
E-AB-65931-01 60 µL

IKBKG Polyclonal Antibody

Sign In for Pricing
View Details
IKBKG Polyclonal Antibody
E-AB-65931-02 120 µL

IKBKG Polyclonal Antibody

Sign In for Pricing
View Details
IKBKG Polyclonal Antibody
E-AB-65931-03 200 µL

IKBKG Polyclonal Antibody

Sign In for Pricing
View Details
ACAD10 (Center) Rabbit Polyclonal Antibody
AP50046PU-N 400 µL

ACAD10 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CHCHD2 Recombinant Rabbit monoclonal Antibody
HA751489 100 µL

CHCHD2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details