Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid hormone (1-34) (rat)

Parathyroid hormone (PTH) receptor agonist; Peptides.

Product Specifications

Product Name Alternative

98614-76-7, AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFPT 040, PT-040, PT040, Parathyroid hormone (1-34) (rat), pTH (1-34) (rat)

Field of Research

Metabolism Research

Purity

> 95% by hplc

Form

Freeze dried solid

Solubility

Soluble to 1 mg/ml in water

Molecular Weight

4057.74 Da

Storage Conditions

Store dry, frozen and in the dark

Notes

For research use only.

AA Sequence

H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phthalamic Acid
TRC-P384250-5G 5 g

Phthalamic Acid

Sign In for Pricing
View Details
MPND (N-term) Rabbit Polyclonal Antibody
AP52736PU-N 400 µL

MPND (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2,4-Dinitro-1H-imidazole
TRC-D479900-500MG 500 mg

2,4-Dinitro-1H-imidazole

Sign In for Pricing
View Details
Tissue FFPE Sections, Synovium
CS714827 5x 5 µm

Tissue FFPE Sections, Synovium

Sign In for Pricing
View Details
MagaDye™ 535-ddGTP
17063-AAT 5 nmoles

MagaDye™ 535-ddGTP

Sign In for Pricing
View Details
C20orf118 (TLDC2) (NM_080628) Human Recombinant Protein
TP315304M 100 µg

C20orf118 (TLDC2) (NM_080628) Human Recombinant Protein

Sign In for Pricing
View Details