Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Parathyroid hormone (1-34) (rat)

Parathyroid hormone (PTH) receptor agonist; Peptides.

Product Specifications

Product Name Alternative

98614-76-7, AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFPT 040, PT-040, PT040, Parathyroid hormone (1-34) (rat), pTH (1-34) (rat)

Field of Research

Metabolism Research

Purity

> 95% by hplc

Form

Freeze dried solid

Solubility

Soluble to 1 mg/ml in water

Molecular Weight

4057.74 Da

Storage Conditions

Store dry, frozen and in the dark

Notes

For research use only.

AA Sequence

H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CytoLinerTM 650/675 Fixed Cell Membrane Stain, 250 labelings
#30134-T 1 Kit

CytoLinerTM 650/675 Fixed Cell Membrane Stain, 250 labelings

Sign In for Pricing
View Details
EGFR (GFR450), Biotin conjugate, 0.1mg/mL
BNCB0450-100 1x 100 µL

EGFR (GFR450), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human MARS2 activation kit by CRISPRa
GA114251 1 Kit

Human MARS2 activation kit by CRISPRa

Sign In for Pricing
View Details
Lactoylglutathione Lyase (CPTC-GLO1-1), CF488A conjugate, 0.1mg/mL
BNC882258-100 1x 100 µL

Lactoylglutathione Lyase (CPTC-GLO1-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZMAT4 Human Gene Knockout Kit (CRISPR)
KN418769 1 Kit

ZMAT4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-9/IL-9 Protein (His Tag)
PKSM041056-01 10 µg

Recombinant Mouse Interleukin-9/IL-9 Protein (His Tag)

Sign In for Pricing
View Details