Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Peptide YY (3-36) (human)

Neuropeptide Y2 receptor agonist; Peptides.

Product Specifications

Product Name Alternative

IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 126339-09-1GH120, PYY (3-36), PYY1-36, Y2 receptor agonist, appetite , food intake, metabolite, weight gain

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in dilute acid

Molecular Weight

4049.6 Da

Storage Conditions

Store dry, dark and frozen

Notes

For research use only.

AA Sequence

H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,3-Dimethyl-1,4-dioxane-2,6-dione
WLD89040-01 50 mg

3,3-Dimethyl-1,4-dioxane-2,6-dione

Sign In for Pricing
View Details
3,3-Dimethyl-1,4-dioxane-2,6-dione
WLD89040-02 0.5 g

3,3-Dimethyl-1,4-dioxane-2,6-dione

Sign In for Pricing
View Details
VPS33A AAV Vector (Human) (CMV)
50180101 1 µg

VPS33A AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Phenyl Purose 6 High Performance
MBS8579612-01 25 mL

Phenyl Purose 6 High Performance

Sign In for Pricing
View Details
Phenyl Purose 6 High Performance
MBS8579612-02 100 mL

Phenyl Purose 6 High Performance

Sign In for Pricing
View Details
Phenyl Purose 6 High Performance
MBS8579612-03 500 mL

Phenyl Purose 6 High Performance

Sign In for Pricing
View Details