Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Peptide YY (3-36) (human)

Neuropeptide Y2 receptor agonist; Peptides.

Product Specifications

Product Name Alternative

IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 126339-09-1GH120, PYY (3-36), PYY1-36, Y2 receptor agonist, appetite , food intake, metabolite, weight gain

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in dilute acid

Molecular Weight

4049.6 Da

Storage Conditions

Store dry, dark and frozen

Notes

For research use only.

AA Sequence

H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem185a (NM_001033328) Mouse Tagged ORF Clone
MR215457 10 µg

Tmem185a (NM_001033328) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
AdmiRa-mmu-miR-7024-5p Virus
mm1780 250 µL

AdmiRa-mmu-miR-7024-5p Virus

Sign In for Pricing
View Details
SMURF1 Protein Vector (Mouse) (pPB-C-His)
PV232122 500 ng

SMURF1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Nr1h5 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
32125064 1.0 µg DNA

Nr1h5 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Transmembrane protein 41B (TMEM41B) ELISA Kit
GTR10332941 96 Well

Rabbit Transmembrane protein 41B (TMEM41B) ELISA Kit

Sign In for Pricing
View Details
E3 ubiquitin-protein ligase Rabbit Polyclonal Antibody
E580522-A-SE 100 µL

E3 ubiquitin-protein ligase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details