Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Peptide YY (human)

Neuropeptide Y agonist that binds all subtypes with similar affinity; Peptides.

Product Specifications

Product Name Alternative

PYY (1-36), 118997-30-1GH110, H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, NPY, PYY, PYY (1-36), Peptide YY, YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, diabetes, food ingestion, gut motility, insulin secretion, neuropeptide Y, obesity

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in dilute acid

Molecular Weight

4049.5 Da

Storage Conditions

Store desiccated, frozen and in the dark

Notes

For research use only.

AA Sequence

H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EphB1/EPHT2 Protein (N-His-GST, Mouse)
P514954 100 µg

EphB1/EPHT2 Protein (N-His-GST, Mouse)

Sign In for Pricing
View Details
Mucin 5B (MUC5B) (MaxLight 490)
MBS6259402-01 0.1 mL

Mucin 5B (MUC5B) (MaxLight 490)

Sign In for Pricing
View Details
Mucin 5B (MUC5B) (MaxLight 490)
MBS6259402-02 5x 0.1 mL

Mucin 5B (MUC5B) (MaxLight 490)

Sign In for Pricing
View Details
Gemin 2 Rabbit mAb
C06467-01 20 µL

Gemin 2 Rabbit mAb

Sign In for Pricing
View Details
Gemin 2 Rabbit mAb
C06467-02 100 µL

Gemin 2 Rabbit mAb

Sign In for Pricing
View Details
Gemin 2 Rabbit mAb
C06467-03 2x 100 μL

Gemin 2 Rabbit mAb

Sign In for Pricing
View Details