Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tat-beclin 1

Autophagy inducing peptide; Cell penetrating peptides.

Product Specifications

Product Name Alternative

1423821-88-8, Beclin-1 Activator ITat-BECN1, Tat-Beclin 1, YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT, beclin 1 peptide

Field of Research

Signal Transduction

Purity

> 95% by hplc

Form

Freeze dried solid

Solubility

Soluble in water

Molecular Weight

3741.15 Da

Storage Conditions

Store dry, frozen and in the dark

Notes

For research use only.

AA Sequence

H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-216a-3p agomir
HY-R00450A-01 5 nmol

Hsa-miR-216a-3p agomir

Sign In for Pricing
View Details
Hsa-miR-216a-3p agomir
HY-R00450A-02 20 nmol

Hsa-miR-216a-3p agomir

Sign In for Pricing
View Details
Methyl 3- (4-oxo-2-sulfanyl-3,4-dihydroquinazolin-3-yl) propanoate
CJB94055-01 250 mg

Methyl 3- (4-oxo-2-sulfanyl-3,4-dihydroquinazolin-3-yl) propanoate

Sign In for Pricing
View Details
Methyl 3- (4-oxo-2-sulfanyl-3,4-dihydroquinazolin-3-yl) propanoate
CJB94055-02 2.5 g

Methyl 3- (4-oxo-2-sulfanyl-3,4-dihydroquinazolin-3-yl) propanoate

Sign In for Pricing
View Details
SH2D5 Blocking Peptide
MBS8308951-01 1 mg

SH2D5 Blocking Peptide

Sign In for Pricing
View Details
SH2D5 Blocking Peptide
MBS8308951-02 5 mg

SH2D5 Blocking Peptide

Sign In for Pricing
View Details