Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SfTSLP (63 aa peptide)

Antimicrobial, the 63 amino acid sequence of the short form of thymic stromal lymphopoietin (sfTSLP) ; Antimicrobial peptides.

Product Specifications

Product Name Alternative

, 63 aa peptide, MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ, sfTSLP

Purity

> 95% by hplc

Form

Freeze dried solid

Molecular Weight

7425.86 Da

Storage Conditions

Store dry, frozen and in the dark

Notes

For research use only.

AA Sequence

H-Met-Phe-Ala-Met-Lys-Thr-Lys-Ala-Ala-Leu-Ala-Ile-Trp-Cys-Pro-Gly-Tyr-Ser-Glu-Thr-Gln-Ile-Asn-Ala-Thr-Gln-Ala-Met-Lys-Lys-Arg-Arg-Lys-Arg-Lys-Val-Thr-Thr-Asn-Lys-Cys-Leu-Glu-Gln-Val-Ser-Gln-Leu-Gln-Gly-Leu-Trp-Arg-Arg-Phe-Asn-Arg-Pro-Leu-Leu-Lys-Gln-Gln-OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat MCSF-Macrophage Colony Stimulating Factor 1- ELISA Kit
E-EL-R0601-01 24 Tests

Rat MCSF-Macrophage Colony Stimulating Factor 1- ELISA Kit

Sign In for Pricing
View Details
Rat MCSF-Macrophage Colony Stimulating Factor 1- ELISA Kit
E-EL-R0601-02 48 Tests

Rat MCSF-Macrophage Colony Stimulating Factor 1- ELISA Kit

Sign In for Pricing
View Details
Rat MCSF-Macrophage Colony Stimulating Factor 1- ELISA Kit
E-EL-R0601-03 96 Tests

Rat MCSF-Macrophage Colony Stimulating Factor 1- ELISA Kit

Sign In for Pricing
View Details
Rat MCSF-Macrophage Colony Stimulating Factor 1- ELISA Kit
E-EL-R0601-04 5x 96 Tests

Rat MCSF-Macrophage Colony Stimulating Factor 1- ELISA Kit

Sign In for Pricing
View Details
Rat MCSF-Macrophage Colony Stimulating Factor 1- ELISA Kit
E-EL-R0601-05 10x 96 Tests

Rat MCSF-Macrophage Colony Stimulating Factor 1- ELISA Kit

Sign In for Pricing
View Details
EIF2AK4/GCN2 Rabbit Polyclonal Antibody (PE)
orb485131 100 µL

EIF2AK4/GCN2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details