Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RG33

Apolipoprotein A1 (ApoA-I) mimetic, improves glucose clearance and control; Peptides.

Product Specifications

Product Name Alternative

Ac-PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN-NH2, ApoA-IGH220, PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN, RG33, amino acid residues 209-241 of apolipoprotein A1, lipid metabolism

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

>3 mg/ml in water

Molecular Weight

3790.41 Da

Storage Conditions

Store desiccated, frozen and in the dark

Notes

For research use only.

AA Sequence

Ac-Pro-Ala-Leu-Glu-Asp-Leu-Arg-Gln-Gly-Leu-Leu-Pro-Val-Leu-Glu-Ser-Phe-Lys-Val-Ser-Phe-Leu-Ser-Ala-Leu-Glu-Glu-Tyr-Thr-Lys-Lys-Leu-Asn-NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ucp3 (NM_009464) Mouse Untagged Clone
MC209616 10 µg

Ucp3 (NM_009464) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Thioalkalivibrio sp. Catalase-peroxidase (katG), partial
MBS1252658 Inquire

Recombinant Thioalkalivibrio sp. Catalase-peroxidase (katG), partial

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (MOC-31), CF640R conjugate, 0.1mg/mL
BNC400380-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (MOC-31), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lentiviral mouse Rpusd2 shRNA (UAS) - Lentiviral mouse Rpusd2 shRNA (UAS, GFP) (100)
GTR15147849 1 Vial

Lentiviral mouse Rpusd2 shRNA (UAS) - Lentiviral mouse Rpusd2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
3-Sulfanylidene-2,4-diazaspiro[5.5]undec-8-ene-1,5-dione
JJB74426-01 50 mg

3-Sulfanylidene-2,4-diazaspiro[5.5]undec-8-ene-1,5-dione

Sign In for Pricing
View Details
3-Sulfanylidene-2,4-diazaspiro[5.5]undec-8-ene-1,5-dione
JJB74426-02 0.5 g

3-Sulfanylidene-2,4-diazaspiro[5.5]undec-8-ene-1,5-dione

Sign In for Pricing
View Details