RG33
Apolipoprotein A1 (ApoA-I) mimetic, improves glucose clearance and control; Peptides.
Product Specifications
Product Name Alternative
Ac-PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN-NH2, ApoA-IGH220, PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN, RG33, amino acid residues 209-241 of apolipoprotein A1, lipid metabolism
Purity
> 95% by HPLC
Form
Freeze dried solid
Solubility
>3 mg/ml in water
Molecular Weight
3790.41 Da
Storage Conditions
Store desiccated, frozen and in the dark
Notes
For research use only.
AA Sequence
Ac-Pro-Ala-Leu-Glu-Asp-Leu-Arg-Gln-Gly-Leu-Leu-Pro-Val-Leu-Glu-Ser-Phe-Lys-Val-Ser-Phe-Leu-Ser-Ala-Leu-Glu-Glu-Tyr-Thr-Lys-Lys-Leu-Asn-NH2
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1605392-01 48 Well
Rat Sulfotransferase Family 1E Member 1, SULT1E1 ELISA Kit
Sign In for Pricing
View Details MBS1605392-02 96 Well
Rat Sulfotransferase Family 1E Member 1, SULT1E1 ELISA Kit
Sign In for Pricing
View Details MBS1605392-03 5x 96 Well
Rat Sulfotransferase Family 1E Member 1, SULT1E1 ELISA Kit
Sign In for Pricing
View Details MBS1605392-04 10x 96 Well
Rat Sulfotransferase Family 1E Member 1, SULT1E1 ELISA Kit
Sign In for Pricing
View Details 