Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL 37 (human), 5-FAM

N-terminally carboxyfluoresceinated derivative of the host defence peptide LL 37; Fluorescent labelled peptides.

Product Specifications

Product Name Alternative

5-FAM AM004, LL 37 (human), LL37, [LL-37, 37 aa], carboxyfluoresceinated, fluorescent detection, host defence peptide LL 37

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in dilute acid

Molecular Weight

4963.6 Da

Storage Conditions

Store dark, frozen and desiccated

Notes

For research use only.

AA Sequence

5-FAM-Ahx-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12) NRFA Polyclonal Antibody
MBS9018070 Inquire

Rabbit anti-Escherichia coli (strain K12) NRFA Polyclonal Antibody

Sign In for Pricing
View Details
Urease-IN-15
orb3134732-01 10 mg

Urease-IN-15

Sign In for Pricing
View Details
Urease-IN-15
orb3134732-02 50 mg

Urease-IN-15

Sign In for Pricing
View Details
FBXL20 (NM_032875) Human Tagged Lenti ORF Clone
RC203527L3 10 µg

FBXL20 (NM_032875) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CAPS Antibody
E30AC1772 100 µL

CAPS Antibody

Sign In for Pricing
View Details
BMS1 Polyclonal Antibody
MBS8530590-01 0.1 mg

BMS1 Polyclonal Antibody

Sign In for Pricing
View Details