LL 37 (human) biotinylated, pegylated
N-terminally biotinylated version of the host defence peptide LL 37; Biotin labelled peptides.
Product Specifications
Product Name Alternative
, AM-200, AM200, Biotin-[PEG (4) ][LL-37, 37 aa]OH, LL 37 (human) biotinylated, LL-37, LL37, [LL-37, 37 aa], PEG (4), angiogenesis, antimicrobial, antitumour, antiviral, biotin, chemotaxis, immunomodulatory, pegylated chain, pegylated is the N-terminally biotinylated
Purity
> 95% by HPLC
Form
Freeze dried solid
Solubility
Soluble in water
Molecular Weight
4967 Da
Storage Conditions
Store frozen, dessicated and in the dark
Notes
For research use only.
AA Sequence
Biotin-[PEG (4) ]-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
QLMM18 150 Reactions
ViPrimePLUS OneStep Taq RT-qPCR Green Master Mix II, 150rxns
Sign In for Pricing
View Details 
