LL 37 (human) biotinylated, pegylated
N-terminally biotinylated version of the host defence peptide LL 37; Biotin labelled peptides.
Product Specifications
Product Name Alternative
, AM-200, AM200, Biotin-[PEG (4) ][LL-37, 37 aa]OH, LL 37 (human) biotinylated, LL-37, LL37, [LL-37, 37 aa], PEG (4), angiogenesis, antimicrobial, antitumour, antiviral, biotin, chemotaxis, immunomodulatory, pegylated chain, pegylated is the N-terminally biotinylated
Purity
> 95% by HPLC
Form
Freeze dried solid
Solubility
Soluble in water
Molecular Weight
4967 Da
Storage Conditions
Store frozen, dessicated and in the dark
Notes
For research use only.
AA Sequence
Biotin-[PEG (4) ]-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
16536-AAT 200 µg
IFluor® 532 goat anti-mouse IgG (H+L) *Cross Adsorbed*
Sign In for Pricing
View Details 
BNC043736-500 1x 500 µL
Vimentin (Mesenchymal Cell Marker) (VIM/3736), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![B7H3 (CD276) Mouse Monoclonal Antibody [Clone ID: OTI1A10]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908f32/imageurl/cf813302.webp)
CF813302 100 µg
B7H3 (CD276) Mouse Monoclonal Antibody [Clone ID: OTI1A10]
Sign In for Pricing
View Details 
BNCB1747-500 1x 500 µL
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details