Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL 37 (human) biotinylated

N-terminally biotinylated version of the host defence peptide LL 37; Biotin labelled peptides.

Product Specifications

Product Name Alternative

6-aminohexanoic acid, 6-carbon spacerAM003, Ahx, LL 37 (human) biotinylated, LL37 (human) biotinylated, LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, N-terminally biotinylated, biotin tag , host defence

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in water

Molecular Weight

4832.5 Da

Storage Conditions

Store dark, frozen and desiccated.

Notes

For research use only.

AA Sequence

Biotin-Ahx- Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Leukocyte Antigen A ELISA Kit
MBS041182-01 48 Well

Monkey Leukocyte Antigen A ELISA Kit

Sign In for Pricing
View Details
Monkey Leukocyte Antigen A ELISA Kit
MBS041182-02 96 Well

Monkey Leukocyte Antigen A ELISA Kit

Sign In for Pricing
View Details
Monkey Leukocyte Antigen A ELISA Kit
MBS041182-03 5x 96 Well

Monkey Leukocyte Antigen A ELISA Kit

Sign In for Pricing
View Details
Monkey Leukocyte Antigen A ELISA Kit
MBS041182-04 10x 96 Well

Monkey Leukocyte Antigen A ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Cullin 1 Protein
NBP1-49441-0.05mg 0.05 mg

Recombinant Human Cullin 1 Protein

Sign In for Pricing
View Details
Rabbit Polyclonal HOOK3 Antibody [DyLight 488]
NBP2-81990G 0.1 mL

Rabbit Polyclonal HOOK3 Antibody [DyLight 488]

Sign In for Pricing
View Details