LL 37 (human) biotinylated
N-terminally biotinylated version of the host defence peptide LL 37; Biotin labelled peptides.
Product Specifications
Product Name Alternative
6-aminohexanoic acid, 6-carbon spacerAM003, Ahx, LL 37 (human) biotinylated, LL37 (human) biotinylated, [LL-37, 37 aa], N-terminally biotinylated, biotin tag , host defence
Purity
> 95% by HPLC
Form
Freeze dried solid
Solubility
Soluble in water
Molecular Weight
4832.5 Da
Storage Conditions
Store dark, frozen and desiccated.
Notes
For research use only.
AA Sequence
Biotin-Ahx- Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
More Discoveries
Explore Other Products
Browse additional items from our catalog