Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LL 37 (human) biotinylated

N-terminally biotinylated version of the host defence peptide LL 37; Biotin labelled peptides.

Product Specifications

Product Name Alternative

6-aminohexanoic acid, 6-carbon spacerAM003, Ahx, LL 37 (human) biotinylated, LL37 (human) biotinylated, [LL-37, 37 aa], N-terminally biotinylated, biotin tag , host defence

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in water

Molecular Weight

4832.5 Da

Storage Conditions

Store dark, frozen and desiccated.

Notes

For research use only.

AA Sequence

Biotin-Ahx- Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Lys-63-specific deubiquitinase BRCC36 Polyclonal Antibody
MBS9416474-01 0.1 mg

Lys-63-specific deubiquitinase BRCC36 Polyclonal Antibody

Sign In for Pricing
View Details
Lys-63-specific deubiquitinase BRCC36 Polyclonal Antibody
MBS9416474-02 5x 0.1 mg

Lys-63-specific deubiquitinase BRCC36 Polyclonal Antibody

Sign In for Pricing
View Details
Daglb siRNA Oligos set (Rat)
17646176 3x 5 nmol

Daglb siRNA Oligos set (Rat)

Sign In for Pricing
View Details
ADAMTS13 Protein Vector (Human) (pPB-His-GST)
PV319847 500 ng

ADAMTS13 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Tris Acetate
MBS6034876-01 100 g

Tris Acetate

Sign In for Pricing
View Details
Tris Acetate
MBS6034876-02 500 g

Tris Acetate

Sign In for Pricing
View Details