Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin-4 (3-39) amide

Glucagon like peptide 1 (GLP-1) receptor antagonist; Peptides.

Product Specifications

Product Name Alternative

196109-31-6, EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Exendin-4 (3-39) amideGH008 ., GLP-1, H-EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, antagonist, glucagon-like peptide 1

Field of Research

Metabolism Research

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in dilute acid

Molecular Weight

3992.4 Da

Storage Conditions

Store desiccated, frozen and in the dark

Notes

For research use only.

AA Sequence

H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ITGA2B Knockout HEK293T cell line
GTR15415914 1 Vial

Human ITGA2B Knockout HEK293T cell line

Sign In for Pricing
View Details
Sar1B HDR Plasmid (h)
sc-412122-HDR 20 µg

Sar1B HDR Plasmid (h)

Sign In for Pricing
View Details
Rabbit Polyclonal MRPS27 Antibody
NBP2-57774 100 µL

Rabbit Polyclonal MRPS27 Antibody

Sign In for Pricing
View Details
E2
60B399b 0.1mg

E2

Sign In for Pricing
View Details
DHX58 (NM_024119) Human Mass Spec Standard
PH304837 10 µg

DHX58 (NM_024119) Human Mass Spec Standard

Sign In for Pricing
View Details
PI4KB Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV661613 1.0 µg DNA

PI4KB Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details