Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin-4

Glucagon like peptide 1 (GLP-1) receptor agonist; Peptides.

Product Specifications

Product Name Alternative

141758-74-9, Exenatide, Exendin-4GH001, GLP-1, HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Heloderma, diabetes mellitus, exenatide, glucagon-like peptide 1, suspectum

Field of Research

Metabolism Research

Purity

> 95% by HPLC

Form

Freeze dried solid

Solubility

Soluble in water (10mg/mL), PBS, dilute acid and DMSO.

Molecular Weight

4186.6 Da

Storage Conditions

Store desiccated at -20°C in the dark

Notes

For research use only.

AA Sequence

H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-Asn-His-NH2
More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ST6GALNAC2 Antibody Picoband®, iFluor647 Conjugate
A10348-iFluor647 100 µg

Anti-ST6GALNAC2 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
CCDC18 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-8189R-BF350 100 µL

CCDC18 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Rat TrxR1 ELISA Kit
E107432 1 Each

Rat TrxR1 ELISA Kit

Sign In for Pricing
View Details
MEKK2 Rabbit Monoclonal Antibody
AMRe02246-01 1 Each

MEKK2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MEKK2 Rabbit Monoclonal Antibody
AMRe02246-02 50 µL

MEKK2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MEKK2 Rabbit Monoclonal Antibody
AMRe02246-03 100 µL

MEKK2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details