What is the catalog number for CRF (human, rat)?

The catalog number for CRF (human, rat) is orb1140510.

What sizes are available for CRF (human, rat)?

CRF (human, rat) is available in the following size(s): 1 mg.

Is CRF (human, rat) in stock?

CRF (human, rat) is currently made to order / not held in immediate stock. Contact us for lead time.

CRF (human, rat)

Endogenous CRF receptor agonist; Peptides.

Product Specifications

Product Name Alternative

86784-80-7CR020, CRF (human, CRH, Corticotropin Releasing Factor (human, Corticotropin releasing factor (human, Corticotropin releasing hormone, SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, rat)

Purity

> 95% by hplc

Form

Freeze dried solid

Solubility

Soluble to 1.10 mg/ml in water

Molecular Weight

4757.51 Da

Storage Conditions

Store dry, frozen and in the dark

Notes

For research use only.

AA Sequence

H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2