Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bay 55-9837

Selective VPAC2 agonist; Peptides.

Product Specifications

Product Name Alternative

463930-25-8, Bay 55-9837, HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2

Purity

> 95% by hplc

Form

Freeze dried solid

Solubility

Soluble to 2 mg/ml in water

Molecular Weight

3742.29 Da

Storage Conditions

Store dry, frozen and in the dark

Notes

For research use only.

AA Sequence

H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ISG15 Antibody Picoband® (Dylight488 Conjugate)
PB9950-Dylight488 100 µg

Anti-ISG15 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
PAPSS1 (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 1, PAPS Synthase 1, PAPSS 1, Sulfurylase Kinase 1, SK 1, SK1, Sulfate Adenylyltransferase, ATP-sulfurylase, Sulfate adenylate Transferase, SAT, Adenylyl-sulfate Kinase, 3'-phosphoadenosin
MBS6458010-01 0.2 mL

PAPSS1 (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 1, PAPS Synthase 1, PAPSS 1, Sulfurylase Kinase 1, SK 1, SK1, Sulfate Adenylyltransferase, ATP-sulfurylase, Sulfate adenylate Transferase, SAT, Adenylyl-sulfate Kinase, 3'-phosphoadenosin

Sign In for Pricing
View Details
PAPSS1 (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 1, PAPS Synthase 1, PAPSS 1, Sulfurylase Kinase 1, SK 1, SK1, Sulfate Adenylyltransferase, ATP-sulfurylase, Sulfate adenylate Transferase, SAT, Adenylyl-sulfate Kinase, 3'-phosphoadenosin
MBS6458010-02 5x 0.2 mL

PAPSS1 (Bifunctional 3'-phosphoadenosine 5'-phosphosulfate Synthase 1, PAPS Synthase 1, PAPSS 1, Sulfurylase Kinase 1, SK 1, SK1, Sulfate Adenylyltransferase, ATP-sulfurylase, Sulfate adenylate Transferase, SAT, Adenylyl-sulfate Kinase, 3'-phosphoadenosin

Sign In for Pricing
View Details
Mouse Dachshund homolog 2 (DACH2) ELISA Kit
orb1669739-01 48 Tests

Mouse Dachshund homolog 2 (DACH2) ELISA Kit

Sign In for Pricing
View Details
Mouse Dachshund homolog 2 (DACH2) ELISA Kit
orb1669739-02 96 Tests

Mouse Dachshund homolog 2 (DACH2) ELISA Kit

Sign In for Pricing
View Details
IFT140 Rabbit pAb, Pacific Blue conjugated
orb2887562 100 µL

IFT140 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details