Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREM-2, Human (HEK293, His)

TREM-2 Protein is a receptor for amyloid beta protein 42, lipoprotein particles, and apolipoprotein. TREM-2 Protein is involved in cell proliferation and apoptosis through Wnt/β, MTOR, PI3K and NF-kappa-B signaling pathways. TREM-2 Protein is expressed by macrophages, immature monocyte-derived dendritic cells, osteoclasts, and microglia to activate the immune response. TREM-2 Protein, Human (HEK293, His) is the recombinant human-derived TREM-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TREM-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trem-2-protein-human-hek-293-his.html

Purity

98.0

Smiles

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS

Molecular Formula

54209 (Gene_ID) Q9NZC2-1 (H19-S174) (Accession)

Molecular Weight

Approximately 22-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKMY2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C12]
TA507314AM 100 µL

ANKMY2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C12]

Sign In for Pricing
View Details
Dynamin-1-Like protein (DNM1L) Bovine ELISA Kit
D0349 96 Tests

Dynamin-1-Like protein (DNM1L) Bovine ELISA Kit

Sign In for Pricing
View Details
Epidermal Growth Factor Receptor Ab multiple clones (erbB, EGFR) (FITC) discontinued
E3375-50-FITC 100 µL

Epidermal Growth Factor Receptor Ab multiple clones (erbB, EGFR) (FITC) discontinued

Sign In for Pricing
View Details
Porcine Positive Cofactor 4 ELISA Kit
MBS750647-01 48 Well

Porcine Positive Cofactor 4 ELISA Kit

Sign In for Pricing
View Details
Porcine Positive Cofactor 4 ELISA Kit
MBS750647-02 96 Well

Porcine Positive Cofactor 4 ELISA Kit

Sign In for Pricing
View Details
Porcine Positive Cofactor 4 ELISA Kit
MBS750647-03 5x 96 Well

Porcine Positive Cofactor 4 ELISA Kit

Sign In for Pricing
View Details