Apelin 36 (human)
Endogenous apelin agonist; Peptides.
Product Specifications
Product Name Alternative
, 252642-12-9, Apelin-36 (human), Apelin36 (human), LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Purity
> 95% by hplc
Form
Freeze dried solid
Solubility
Soluble to 1 mg/ml in water
Molecular Weight
4195.87 Da
Storage Conditions
Store dry, frozen and in the dark
Notes
For research use only.
AA Sequence
H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10373116 96 Well
Monkey BAG family molecular chaperone regulator 2 ELISA kit
Sign In for Pricing
View Details 
HY-W168915S-01 5 mg
1- (3-Fluorophenyl) -6-oxo-1,6-dihydropyridine-3-carboxylic acid-d3
Sign In for Pricing
View Details HY-W168915S-02 1 mg
1- (3-Fluorophenyl) -6-oxo-1,6-dihydropyridine-3-carboxylic acid-d3
Sign In for Pricing
View Details 
ELI-39648m 96 Tests
Mouse Neuronal PAS domain-containing protein 3, Npas3 ELISA KIT
Sign In for Pricing
View Details MBS6200817-01 0.1 mL
FERMT1 (C20orf42, Kindlerin, Kindlin Syndrome Protein, Kindlin-1, Unc-112-related Protein 1, Fermitin Family Homolog 1, KIND1, URP1, FLJ20116, FLJ23423) (MaxLight 490)
Sign In for Pricing
View Details