Apelin 36 (human)
Endogenous apelin agonist; Peptides.
Product Specifications
Product Name Alternative
, 252642-12-9, Apelin-36 (human), Apelin36 (human), LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Purity
> 95% by hplc
Form
Freeze dried solid
Solubility
Soluble to 1 mg/ml in water
Molecular Weight
4195.87 Da
Storage Conditions
Store dry, frozen and in the dark
Notes
For research use only.
AA Sequence
H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV783055 1.0 µg DNA
RPS12P20 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details 9187-2384 2380 / Box
Cryo-Babies, small, red labels for 0.5 mL tubes, 0.94 inch L x 0.5 inch W, 119/sheet, 2380/box
Sign In for Pricing
View Details 
VD4N133 1 Each
Rabbit Anti-Mouse Interferon Alpha 11 (IFNa11) Polyclonal Antibody
Sign In for Pricing
View Details MBS1421667-01 0.02 mg (E-Coli)
Recombinant Staphylococcus epidermidis Probable tRNA sulfurtransferase (thiI)
Sign In for Pricing
View Details MBS1421667-02 0.02 mg (Yeast)
Recombinant Staphylococcus epidermidis Probable tRNA sulfurtransferase (thiI)
Sign In for Pricing
View Details