Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OBCAM/OPCML, Rat (HEK293, Fc)

OBCAM/OPCML Protein binds opioids in acidic lipid environments, influencing cellular communication and facilitating cell contact, potentially impacting various biological processes. OBCAM/OPCML Protein, Rat (HEK293, Fc) is the recombinant rat-derived OBCAM/OPCML protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

OBCAM/OPCML Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/obcam-opcml-protein-rat-hek293-fc.html

Purity

97.80

Smiles

GVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEISSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGV

Molecular Formula

116597 (Gene_ID) P32736-1 (G28-V321) (Accession)

Molecular Weight

Approximately 90 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti Rat IgG2a (subclass specific), conjugated with FITC
GARa/IgG2a/FITC 1 mL

Goat anti Rat IgG2a (subclass specific), conjugated with FITC

Sign In for Pricing
View Details
Olr69 Rat siRNA Oligo Duplex (Locus ID 365326)
SR508021 1 Kit

Olr69 Rat siRNA Oligo Duplex (Locus ID 365326)

Sign In for Pricing
View Details
NestShield® Extra Thick Nitrile Examination Gloves, Black, 6 mil, powder free, large, 100/pk, 1000/cs
CS0058-902831 1 Each

NestShield® Extra Thick Nitrile Examination Gloves, Black, 6 mil, powder free, large, 100/pk, 1000/cs

Sign In for Pricing
View Details
Toddalosin ethyl ether
MBS5787996 Inquire

Toddalosin ethyl ether

Sign In for Pricing
View Details
Human Lipase, Gastric (LIPF) ELISA Kit
MBS160592-01 48 Well

Human Lipase, Gastric (LIPF) ELISA Kit

Sign In for Pricing
View Details
Human Lipase, Gastric (LIPF) ELISA Kit
MBS160592-02 96 Well

Human Lipase, Gastric (LIPF) ELISA Kit

Sign In for Pricing
View Details