Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mannose-binding protein C (Mbl2)

Product Specifications

Product Name Alternative

MBP-C; Mannan-binding protein; RA-reactive factor P28A subunit; RARF/P28A

Abbreviation

Recombinant Mouse Mbl2 protein

Gene Name

Mbl2

UniProt

P41317

Expression Region

19-244aa

Organism

Mus musculus (Mouse)

Target Sequence

ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amplite® Colorimetric Glucose-6-Phosphate Assay Kit
13805-AAT 200 Tests

Amplite® Colorimetric Glucose-6-Phosphate Assay Kit

Sign In for Pricing
View Details
APRG1 (C3orf35) (NM_001302831) Human Tagged ORF Clone
RG235767 10 µg

APRG1 (C3orf35) (NM_001302831) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mannose Receptor (CD206) Recombinant Chimeric Antibody Antibody
HA601452 100 µL

Mannose Receptor (CD206) Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Replication Protein A2 (RPA2) (RPA2/3140R), CF594 conjugate, 0.1mg/mL
BNC943140-100 1x 100 µL

Replication Protein A2 (RPA2) (RPA2/3140R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hostanox 03
TRC-H010305-25MG 25 mg

Hostanox 03

Sign In for Pricing
View Details
4-(p-Chloro-alpha-phenylbenzyl)-1-piperazineethanol Dihydrochloride
TRC-C377570-250MG 250 mg

4-(p-Chloro-alpha-phenylbenzyl)-1-piperazineethanol Dihydrochloride

Sign In for Pricing
View Details