IFN-gamma, Rat (CHO)
IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.
Product Specifications
Product Name Alternative
IFN-gamma Protein, Rat (CHO), Rat, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-gamma-protein-rat-cho.html
Purity
95.00
Smiles
QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Molecular Formula
25712 (Gene_ID) P01581 (Q23-C156) (Accession)
Molecular Weight
Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR201579L4V 200 µL
Mrpl13 (NM_026759) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
GTR15367739 1 Vial
Lentiviral human TECPR2 sgRNA gene knockout kit - Lentiviral human TECPR2 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 