Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Rat (CHO)

IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-rat-cho.html

Purity

95.00

Smiles

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Molecular Formula

25712 (Gene_ID) P01581 (Q23-C156) (Accession)

Molecular Weight

Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin-2 Antibody / IL-2
V5041-100UG 100 µg

Interleukin-2 Antibody / IL-2

Sign In for Pricing
View Details
Cfap53 Mouse shRNA Lentiviral Particle (Locus ID 74453)
TL519482V 500 µL Each

Cfap53 Mouse shRNA Lentiviral Particle (Locus ID 74453)

Sign In for Pricing
View Details
KRT18P34 Protein Vector (Human) (pPM-C-His)
PV089589 500 ng

KRT18P34 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal HLA Class I Antibody (MEM-81) [mFluor Violet 450 SE]
NB500-412MFV450 0.1 mL

Mouse Monoclonal HLA Class I Antibody (MEM-81) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
KIR2DS5 Conjugated Antibody
MBS9453982-01 0.1 mL (AF350)

KIR2DS5 Conjugated Antibody

Sign In for Pricing
View Details
KIR2DS5 Conjugated Antibody
MBS9453982-02 0.1 mL (AF405)

KIR2DS5 Conjugated Antibody

Sign In for Pricing
View Details