IFN-gamma, Rat (CHO)
IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.
Product Specifications
Product Name Alternative
IFN-gamma Protein, Rat (CHO), Rat, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-gamma-protein-rat-cho.html
Purity
95.00
Smiles
QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Molecular Formula
25712 (Gene_ID) P01581 (Q23-C156) (Accession)
Molecular Weight
Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-8500R-BF647 100 µL
RFTN2 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
Sign In for Pricing
View Details 
K0524803 1.0 µg DNA
CTBS sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details K0693308 1.0 µg DNA
ERMAP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details