Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Rat (CHO)

IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-rat-cho.html

Purity

95.00

Smiles

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Molecular Formula

25712 (Gene_ID) P01581 (Q23-C156) (Accession)

Molecular Weight

Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kifc3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7277307 1.0 µg DNA

Kifc3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
MAST2 Knockout Cell Lysate
ABC-KC1123 100 µg

MAST2 Knockout Cell Lysate

Sign In for Pricing
View Details
Mouse Ogg1 Pre-designed siRNA Set A
SI109797A 1 Each

Mouse Ogg1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Monoclonal HLA G Antibody (MEM-G/9) [Alexa Fluor 647]
NB500-314AF647 0.1 mL

Mouse Monoclonal HLA G Antibody (MEM-G/9) [Alexa Fluor 647]

Sign In for Pricing
View Details
Recombinant Human Fragile X mental retardation syndrome-related protein 2 (FXR2)
MBS950529-01 0.02 mg (E-Coli)

Recombinant Human Fragile X mental retardation syndrome-related protein 2 (FXR2)

Sign In for Pricing
View Details
Recombinant Human Fragile X mental retardation syndrome-related protein 2 (FXR2)
MBS950529-02 0.02 mg (Yeast)

Recombinant Human Fragile X mental retardation syndrome-related protein 2 (FXR2)

Sign In for Pricing
View Details