Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Rat (CHO)

IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-rat-cho.html

Purity

95.00

Smiles

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Molecular Formula

25712 (Gene_ID) P01581 (Q23-C156) (Accession)

Molecular Weight

Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FASTK Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV710057 1.0 µg DNA

FASTK Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rat Asporin ELISA Kit
MBS732794-01 48 Well

Rat Asporin ELISA Kit

Sign In for Pricing
View Details
Rat Asporin ELISA Kit
MBS732794-02 96 Well

Rat Asporin ELISA Kit

Sign In for Pricing
View Details
Rat Asporin ELISA Kit
MBS732794-03 5x 96 Well

Rat Asporin ELISA Kit

Sign In for Pricing
View Details
Rat Asporin ELISA Kit
MBS732794-04 10x 96 Well

Rat Asporin ELISA Kit

Sign In for Pricing
View Details
Easypro Human Cytokeratin 20 (CK-20/KRT20) ELISA Kit
FY-EH2215S 96 Well

Easypro Human Cytokeratin 20 (CK-20/KRT20) ELISA Kit

Sign In for Pricing
View Details