Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Rat (CHO)

IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-rat-cho.html

Purity

95.00

Smiles

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Molecular Formula

25712 (Gene_ID) P01581 (Q23-C156) (Accession)

Molecular Weight

Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maob (NM_013198) Rat Tagged ORF Clone
RR202532 10 µg

Maob (NM_013198) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Trps1 shRNA (UAS) - Lentiviral mouse Trps1 shRNA (UAS, iRFP) (25)
GTR15200582 1 Vial

Lentiviral mouse Trps1 shRNA (UAS) - Lentiviral mouse Trps1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
UBE3AP2 3'UTR Luciferase Stable Cell Line
TU027701 1.0 mL

UBE3AP2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Begain Recombinant Protein Antigen
NBP1-82907PEP 0.1 mL

Begain Recombinant Protein Antigen

Sign In for Pricing
View Details
CLP1 (HEAB, Polyribonucleotide 5'-hydroxyl-kinase Clp1, Polynucleotide Kinase Clp1, Pre-mRNA Cleavage Complex II Protein Clp1) (HRP)
125088-HRP 100 µL

CLP1 (HEAB, Polyribonucleotide 5'-hydroxyl-kinase Clp1, Polynucleotide Kinase Clp1, Pre-mRNA Cleavage Complex II Protein Clp1) (HRP)

Sign In for Pricing
View Details
USP48 Adenovirus (Human)
49333051 1.0 mL

USP48 Adenovirus (Human)

Sign In for Pricing
View Details