IFN-gamma, Rat (CHO)
IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.
Product Specifications
Product Name Alternative
IFN-gamma Protein, Rat (CHO), Rat, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-gamma-protein-rat-cho.html
Purity
95.00
Smiles
QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Molecular Formula
25712 (Gene_ID) P01581 (Q23-C156) (Accession)
Molecular Weight
Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
9185-0504 1000 / Roll
Tough-Spots, large, red labels for 1.5 mL and 2.0 mL tubes, 1/2 inch diameter, 1000/roll. For -196C to +80C.
Sign In for Pricing
View Details 
K6051702 1.0 µg DNA
Ccdc62 sgRNA CRISPR Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details NBP2-60678PECY55 0.5 mL
Goat Polyclonal Goat anti-Human IgG Fc Secondary Antibody [PE/Cy5.5]
Sign In for Pricing
View Details 
bs-8245R-BF594-01 20 µL
Alpha casein Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
Sign In for Pricing
View Details 
bs-8245R-BF594-02 100 µL
Alpha casein Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
Sign In for Pricing
View Details