IFN-gamma, Rat (CHO)

IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-rat-cho.html

Purity

95.00

Smiles

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Molecular Formula

25712 (Gene_ID) P01581 (Q23-C156) (Accession)

Molecular Weight

Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTR15370056 1 Vial

Lentiviral human UCK2 sgRNA gene knockout kit - Lentiviral human UCK2 sgRNA gene knockout kit (25)

View Details

abx068999-01 10 µg

Human Secreted Frizzled Related Protein 5 (SFRP5) Protein

View Details

abx068999-02 50 µg

Human Secreted Frizzled Related Protein 5 (SFRP5) Protein

View Details

abx068999-03 100 µg

Human Secreted Frizzled Related Protein 5 (SFRP5) Protein

View Details

abx068999-04 200 µg

Human Secreted Frizzled Related Protein 5 (SFRP5) Protein

View Details

abx068999-05 500 µg

Human Secreted Frizzled Related Protein 5 (SFRP5) Protein

View Details