IFN-gamma, Rat (CHO)
IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.
Product Specifications
Product Name Alternative
IFN-gamma Protein, Rat (CHO), Rat, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-gamma-protein-rat-cho.html
Purity
95.00
Smiles
QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Molecular Formula
25712 (Gene_ID) P01581 (Q23-C156) (Accession)
Molecular Weight
Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV791352 1.0 µg DNA
CLDN12 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
Sign In for Pricing
View Details 
MR221226L4 10 µg
Ldlrad1 (NM_001081272) Mouse Tagged Lenti ORF Clone
Sign In for Pricing
View Details 
FAB20871PEATT594 0.1 mL
Mouse Monoclonal FCRL5/FCRL3 Antibody (307307) [PE/Atto594]
Sign In for Pricing
View Details GTR15387224 1 Vial
Lentiviral human SLC20A1 sgRNA gene knockout kit - Lentiviral human SLC20A1 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details