Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Rat (CHO)

IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-rat-cho.html

Purity

95.00

Smiles

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Molecular Formula

25712 (Gene_ID) P01581 (Q23-C156) (Accession)

Molecular Weight

Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPK2 (Receptor TNFRSF Interacting Serine Threonine Kinase 2) BioAssayTM ELISA Kit (Human) discontinued
358568-01 48 Tests

RIPK2 (Receptor TNFRSF Interacting Serine Threonine Kinase 2) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
RIPK2 (Receptor TNFRSF Interacting Serine Threonine Kinase 2) BioAssayTM ELISA Kit (Human) discontinued
358568-02 96 Tests

RIPK2 (Receptor TNFRSF Interacting Serine Threonine Kinase 2) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Smim20 (NM_001145433) Mouse Tagged Lenti ORF Clone
MR212796L4 10 µg

Smim20 (NM_001145433) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human EP300 knockout cell line
ABC-KH4817 1 Vial

Human EP300 knockout cell line

Sign In for Pricing
View Details
Recombinant SYP Antibody / Synaptophysin
V9154-100UG 100 µg

Recombinant SYP Antibody / Synaptophysin

Sign In for Pricing
View Details
Alyref2 (NM_019484) Mouse Tagged Lenti ORF Clone
MR219189L4 10 µg

Alyref2 (NM_019484) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details