Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Rat (CHO)

IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-rat-cho.html

Purity

95.00

Smiles

QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC

Molecular Formula

25712 (Gene_ID) P01581 (Q23-C156) (Accession)

Molecular Weight

Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34 (10) :759-68.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTDH Mouse Monoclonal Antibody
AMM82873-01 1 Each

MTDH Mouse Monoclonal Antibody

Sign In for Pricing
View Details
MTDH Mouse Monoclonal Antibody
AMM82873-02 50 µL

MTDH Mouse Monoclonal Antibody

Sign In for Pricing
View Details
MTDH Mouse Monoclonal Antibody
AMM82873-03 100 µL

MTDH Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Cse1l shRNA (UAS) - Lentiviral mouse Cse1l shRNA (UAS) (25)
GTR15187469 1 Vial

Lentiviral mouse Cse1l shRNA (UAS) - Lentiviral mouse Cse1l shRNA (UAS) (25)

Sign In for Pricing
View Details
Gemin 2 (GEMIN2) (NM_003616) Human Recombinant Protein
TP311219 20 µg

Gemin 2 (GEMIN2) (NM_003616) Human Recombinant Protein

Sign In for Pricing
View Details
Arnt2 sgRNA CRISPR Lentivector set (Mouse)
K3424501 3x 1.0 µg

Arnt2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details