BMPR-II, Human (HEK293, His)

BMP Type II Receptor (BMPR2) is a type II member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. BMPR2 is highly expressed in the heart and liver, and involves in osteogenesis and cell differentiation, essential for embryogenesis, development, and adult tissue homeostasis[1][2]. BMPR2 is associated with tubulin stability, the inhibition of BMPR2 destabilizes the microtubules promoting cell death of cancer cells that involves the activation of the lysosomes[3]. Human BMPR2 protein contains 1038 amino acids and a transmembrane domain (151-171 a.a.) . BMPR-II Protein, Human (HEK293, His) is the extracellular part of the complete BMPR2 protein, produced by HEK293 cells (S27-I151) with C-terminal 6*His-tag.

Product Specifications

Product Name Alternative

BMPR-II Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmpr-ii-protein-human-hek293-his.html

Purity

98.0

Smiles

SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIHHHHHH

Molecular Formula

659 (Gene_ID) Q13873-1 (S27-I151) (Accession)

Molecular Weight

28-40 kDa

References & Citations

[1]Kim MJ, et al. Clinical significance linked to functional defects in bone morphogenetic protein type 2 receptor, BMPR2. BMB Rep. 2017;50 (6) :308-317.|[2]Xu B, et al. The role of TGF-β or BMPR2 signaling pathway-related miRNA in pulmonary arterial hypertension and systemic sclerosis. Arthritis Res Ther. 2021 Nov 25;23 (1) :288.|[3]ten Dijke P, et al. Signaling via hetero-oligomeric complexes of type I and type II serine/threonine kinase receptors. Curr Opin Cell Biol. 1996 Apr;8 (2) :139-45.|[4]Mondal A, et al. Bone morphogenetic protein receptor 2 inhibition destabilizes microtubules promoting the activation of lysosomes and cell death of lung cancer cells. Cell Commun Signal. 2021 Sep 25;19 (1) :97.|[5]Li N, et al. BMPR2 promoter methylation and its expression in valvular heart disease complicated with pulmonary artery hypertension. Aging (Albany NY) . 2021 Nov 18;13 (22) :24580-24604.