Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMPR-II, Human (HEK293, His)

BMP Type II Receptor (BMPR2) is a type II member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. BMPR2 is highly expressed in the heart and liver, and involves in osteogenesis and cell differentiation, essential for embryogenesis, development, and adult tissue homeostasis[1][2]. BMPR2 is associated with tubulin stability, the inhibition of BMPR2 destabilizes the microtubules promoting cell death of cancer cells that involves the activation of the lysosomes[3]. Human BMPR2 protein contains 1038 amino acids and a transmembrane domain (151-171 a.a.) . BMPR-II Protein, Human (HEK293, His) is the extracellular part of the complete BMPR2 protein, produced by HEK293 cells (S27-I151) with C-terminal 6*His-tag.

Product Specifications

Product Name Alternative

BMPR-II Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmpr-ii-protein-human-hek293-his.html

Purity

98.0

Smiles

SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIHHHHHH

Molecular Formula

659 (Gene_ID) Q13873-1 (S27-I151) (Accession)

Molecular Weight

28-40 kDa

References & Citations

[1]Kim MJ, et al. Clinical significance linked to functional defects in bone morphogenetic protein type 2 receptor, BMPR2. BMB Rep. 2017;50 (6) :308-317.|[2]Xu B, et al. The role of TGF-β or BMPR2 signaling pathway-related miRNA in pulmonary arterial hypertension and systemic sclerosis. Arthritis Res Ther. 2021 Nov 25;23 (1) :288.|[3]ten Dijke P, et al. Signaling via hetero-oligomeric complexes of type I and type II serine/threonine kinase receptors. Curr Opin Cell Biol. 1996 Apr;8 (2) :139-45.|[4]Mondal A, et al. Bone morphogenetic protein receptor 2 inhibition destabilizes microtubules promoting the activation of lysosomes and cell death of lung cancer cells. Cell Commun Signal. 2021 Sep 25;19 (1) :97.|[5]Li N, et al. BMPR2 promoter methylation and its expression in valvular heart disease complicated with pulmonary artery hypertension. Aging (Albany NY) . 2021 Nov 18;13 (22) :24580-24604.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3galt6 Mouse shRNA Plasmid (Locus ID 117592)
TR506016 1 Kit

B3galt6 Mouse shRNA Plasmid (Locus ID 117592)

Sign In for Pricing
View Details
LIN9 Recombinant Protein (Mouse)
RP147548 100 µg

LIN9 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Bovine OJ/lleRS ELISA Kit
EBO0317 96 Tests

Bovine OJ/lleRS ELISA Kit

Sign In for Pricing
View Details
Ifi44l Mouse Gene Knockout Kit (CRISPR)
KN508112 1 Kit

Ifi44l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPS15AP17 ORF Vector (Human) (pORF)
ORF031252 1.0 µg DNA

RPS15AP17 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ALDH2 modulator 1
M36013-01 1 g

ALDH2 modulator 1

Sign In for Pricing
View Details