Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMPR-II, Human (HEK293, His)

BMP Type II Receptor (BMPR2) is a type II member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. BMPR2 is highly expressed in the heart and liver, and involves in osteogenesis and cell differentiation, essential for embryogenesis, development, and adult tissue homeostasis[1][2]. BMPR2 is associated with tubulin stability, the inhibition of BMPR2 destabilizes the microtubules promoting cell death of cancer cells that involves the activation of the lysosomes[3]. Human BMPR2 protein contains 1038 amino acids and a transmembrane domain (151-171 a.a.) . BMPR-II Protein, Human (HEK293, His) is the extracellular part of the complete BMPR2 protein, produced by HEK293 cells (S27-I151) with C-terminal 6*His-tag.

Product Specifications

Product Name Alternative

BMPR-II Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bmpr-ii-protein-human-hek293-his.html

Purity

98.0

Smiles

SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIHHHHHH

Molecular Formula

659 (Gene_ID) Q13873-1 (S27-I151) (Accession)

Molecular Weight

28-40 kDa

References & Citations

[1]Kim MJ, et al. Clinical significance linked to functional defects in bone morphogenetic protein type 2 receptor, BMPR2. BMB Rep. 2017;50 (6) :308-317.|[2]Xu B, et al. The role of TGF-β or BMPR2 signaling pathway-related miRNA in pulmonary arterial hypertension and systemic sclerosis. Arthritis Res Ther. 2021 Nov 25;23 (1) :288.|[3]ten Dijke P, et al. Signaling via hetero-oligomeric complexes of type I and type II serine/threonine kinase receptors. Curr Opin Cell Biol. 1996 Apr;8 (2) :139-45.|[4]Mondal A, et al. Bone morphogenetic protein receptor 2 inhibition destabilizes microtubules promoting the activation of lysosomes and cell death of lung cancer cells. Cell Commun Signal. 2021 Sep 25;19 (1) :97.|[5]Li N, et al. BMPR2 promoter methylation and its expression in valvular heart disease complicated with pulmonary artery hypertension. Aging (Albany NY) . 2021 Nov 18;13 (22) :24580-24604.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKAR2B (NM_002736) Human Tagged ORF Clone
RG209900 10 µg

PRKAR2B (NM_002736) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse M-CSF MAb (Clone 131614)
MAB4161 500 µg

Mouse M-CSF MAb (Clone 131614)

Sign In for Pricing
View Details
TGF-beta-3 (TGFB3) (24-412, His-tag) Human Protein
AR51846PU-S 100 µg

TGF-beta-3 (TGFB3) (24-412, His-tag) Human Protein

Sign In for Pricing
View Details
UBA6 3'UTR GFP Stable Cell Line
TU077613 1.0 mL

UBA6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Macrophage Colony-Stimulating Factor 1 Receptor Phospho-Tyr561 (CSF1R pY561) Antibody
abx012479-01 10 µg

Macrophage Colony-Stimulating Factor 1 Receptor Phospho-Tyr561 (CSF1R pY561) Antibody

Sign In for Pricing
View Details
Macrophage Colony-Stimulating Factor 1 Receptor Phospho-Tyr561 (CSF1R pY561) Antibody
abx012479-02 100 µg

Macrophage Colony-Stimulating Factor 1 Receptor Phospho-Tyr561 (CSF1R pY561) Antibody

Sign In for Pricing
View Details