Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Novel Coronavirus Spike glycoprotein (S), partial

This Recombinant Human Novel Coronavirus Spike glycoprotein (S), partial spans the amino acid sequence from region 16-318aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(S glycoprotein) (Peplomer protein) (Spike protein S1) (Spike protein S2)

UniProt

P0DTC2

Expression Region

16-318aa

Tag

N-terminal 6xHis-PDI-tagged

Source

Yeast

Origin

Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

93.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-Ifit1 Plasmid
PVT44653 2 µg

pCMV-SPORT6-Ifit1 Plasmid

Sign In for Pricing
View Details
Cartilage, Nasal, Bovine
C1387-20 100 g

Cartilage, Nasal, Bovine

Sign In for Pricing
View Details
Rabbit Polyclonal CXCR3 Antibody [Alexa Fluor 350]
NBP2-41250AF350 0.1 mL

Rabbit Polyclonal CXCR3 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Vitavel A
AB2985 20 mg

Vitavel A

Sign In for Pricing
View Details
Human RNLS Pre-designed siRNA Set A
SI013918A 1 Each

Human RNLS Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human SPANXN3 qPCR Primer Pair
QH63309S 200 Tests

Human SPANXN3 qPCR Primer Pair

Sign In for Pricing
View Details