Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial
This Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial spans the amino acid sequence from region 306-527aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(S glycoprotein) (E2) (Peplomer protein)
UniProt
P59594
Expression Region
306-527aa
Tag
C-terminal 6xHis-tagged
Source
Mammalian cell
Origin
Severe acute respiratory syndrome coronavirus (SARS-CoV)
Field of Research
Respiratory Research
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Lyophilized powder
Molecular Weight
27.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered 20mM Tris-HCl,400mM NaCl,6% Trehalose, pH 7.0
AA Sequence
RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400669-500 1x 500 µL
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040270-100 1x 100 µL
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400204-500 1x 500 µL
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details