Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein&Membrane protein (E&M), partial

This Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein (E & M), partial spans the amino acid sequence from region 1-42aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0DTC5, P0DTC4

Expression Region

1-42aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Field of Research

Respiratory Research; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

MYSFVSEETGTLIVNSADSNGTITVEELKKLLEQRINWITGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCSK9 Recombinant Rabbit mAb (SDT-424-252)
S0B3245-01 0.1 mg

PCSK9 Recombinant Rabbit mAb (SDT-424-252)

Sign In for Pricing
View Details
PCSK9 Recombinant Rabbit mAb (SDT-424-252)
S0B3245-02 0.5 mg

PCSK9 Recombinant Rabbit mAb (SDT-424-252)

Sign In for Pricing
View Details
PCSK9 Recombinant Rabbit mAb (SDT-424-252)
S0B3245-03 1 mg

PCSK9 Recombinant Rabbit mAb (SDT-424-252)

Sign In for Pricing
View Details
Rabbit Monoclonal IkB-alpha Antibody (116) [mFluor Violet 500 SE]
NBP2-90043MFV500 0.1 mL

Rabbit Monoclonal IkB-alpha Antibody (116) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
DNMT1 (NM_001130823) Human Over-expression Lysate
LS001786 100 µg

DNMT1 (NM_001130823) Human Over-expression Lysate

Sign In for Pricing
View Details
Gossypolone
M34612-01 1 g

Gossypolone

Sign In for Pricing
View Details