Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)

This Recombinant Human coronavirus HKU1 Non-structural protein 4 (4) spans the amino acid sequence from region 1-109aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Accessory protein 4 Non-structural protein of 12.5 kDa Orf4 protein

UniProt

Q0ZME6

Expression Region

1-109aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Human coronavirus HKU1 (isolate N5) (HCoV-HKU1)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEVWRPSYKYSLITREFGVTDLEDLCFKYNYCQPCVGYCIVPLNVWCRKFGKFASYFVLRSHDTSHKNNFGVITSFTSYGNTVSEAVSKLVESASDFIAWRAEALNKYG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Spectrin Beta Chain, Erythrocyte (SPTB) ELISA Kit
MBS9390970-01 48 Well

Rat Spectrin Beta Chain, Erythrocyte (SPTB) ELISA Kit

Sign In for Pricing
View Details
Rat Spectrin Beta Chain, Erythrocyte (SPTB) ELISA Kit
MBS9390970-02 96 Well

Rat Spectrin Beta Chain, Erythrocyte (SPTB) ELISA Kit

Sign In for Pricing
View Details
Rat Spectrin Beta Chain, Erythrocyte (SPTB) ELISA Kit
MBS9390970-03 5x 96 Well

Rat Spectrin Beta Chain, Erythrocyte (SPTB) ELISA Kit

Sign In for Pricing
View Details
Rat Spectrin Beta Chain, Erythrocyte (SPTB) ELISA Kit
MBS9390970-04 10x 96 Well

Rat Spectrin Beta Chain, Erythrocyte (SPTB) ELISA Kit

Sign In for Pricing
View Details
NOTCH2NL (Notch Homolog 2 (Drosophila) N-terminal like, N2N) (MaxLight 750) discontinued
249405-ML750 100 µL

NOTCH2NL (Notch Homolog 2 (Drosophila) N-terminal like, N2N) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MMP16 (NM_005941) Human Over-expression Lysate
E45H07950-2 20 µg

MMP16 (NM_005941) Human Over-expression Lysate

Sign In for Pricing
View Details