Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Spike glycoprotein (S), partial

This Recombinant Bovine coronavirus Spike glycoprotein (S), partial spans the amino acid sequence from region 314-634aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S glycoprotein, E2, Peplomer protein

UniProt

P25191

Expression Region

314-634aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Bovine coronavirus (strain L9) (BCoV) (BCV)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSCLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCTCQPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OX40 / CD134/ TNFRSF4 (Immuno-Oncology Target) (OX40/3108), CF740 conjugate, 0.1mg/mL
BNC743108-500 1x 500 µL

OX40 / CD134/ TNFRSF4 (Immuno-Oncology Target) (OX40/3108), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGDN Mouse Monoclonal Antibody [Clone ID: OTI8B5]
CF808856 100 µg

NGDN Mouse Monoclonal Antibody [Clone ID: OTI8B5]

Sign In for Pricing
View Details
TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), CF740 conjugate, 0.1mg/mL
BNC743113-100 1x 100 µL

TIM3 / HAVCR2 / CD366 (Effector T-Cell Marker) (TIM3/3113), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Iodoheptafluoropropane
TRC-I754340-500MG 500 mg

1-Iodoheptafluoropropane

Sign In for Pricing
View Details
Osteopontin (SPP1) (NM_000582) Human Recombinant Protein
TP305118M 100 µg

Osteopontin (SPP1) (NM_000582) Human Recombinant Protein

Sign In for Pricing
View Details
N-Boc-pyrrolidine
TRC-B665850-25G 25 g

N-Boc-pyrrolidine

Sign In for Pricing
View Details