Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Spike glycoprotein (S), partial

This Recombinant Bovine coronavirus Spike glycoprotein (S), partial spans the amino acid sequence from region 314-634aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S glycoprotein, E2, Peplomer protein

UniProt

P25192

Expression Region

314-634aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Bovine coronavirus (strain LY-138) (BCoV) (BCV)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVQPIADVYRRIPNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIDAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTATSCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTDHDVVYAQHCFKAPTNFCPCKLDGSLCVGSGSGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPITSKSTGPYKCPQTKYLVGIGEHCSGLAIKSDYCGGNPCTCQPQAFLGWSVDSCLQGDRCNIFANFILHDVNSGTTCSTDLQKSNTDIILGVCVNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPANXA1 activation kit by CRISPRa
GA109378 1 Kit

Human SPANXA1 activation kit by CRISPRa

Sign In for Pricing
View Details
GF-1 Bacterial Starter Kit / Chromo Taq DNA Polymerase, 25 preps
GF-BA-KW 25 Preparations

GF-1 Bacterial Starter Kit / Chromo Taq DNA Polymerase, 25 preps

Sign In for Pricing
View Details
14-3-3 zeta (YWHAZ) Rabbit Polyclonal Antibody
AP20468PU-N 100 µg

14-3-3 zeta (YWHAZ) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MEK7 (MAP2K7) Rabbit Polyclonal Antibody
AP21117PU-N 100 µg

MEK7 (MAP2K7) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RFC4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A8]
TA506183AM 100 µL

RFC4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A8]

Sign In for Pricing
View Details
DOCK2 Rabbit Polyclonal Antibody
TA375577 100 µL

DOCK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details