Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

This Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) spans the amino acid sequence from region 1-45aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ns4.8, 4.8 kDa accessory protein

UniProt

P0C2R2

Expression Region

1-45aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-LUN) (BCV)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPMATTIEGADYTNIMPITVLTTVYLGVSIGIDTSTTGFTCFSRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NT 4 Protein
OPPA01844-2UG 2 µg

NT 4 Protein

Sign In for Pricing
View Details
PURA Polyclonal Antibody
A69671-050 50 µL

PURA Polyclonal Antibody

Sign In for Pricing
View Details
FAAP24 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2512138 100 µL

FAAP24 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Embigin Rabbit pAb, AE conjugated
orb2877553 100 µL

Embigin Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
RpsH Antibody
orb828602 2 mg

RpsH Antibody

Sign In for Pricing
View Details
Rat Ropn1l Pre-designed siRNA Set B
SI212093B 1 Each

Rat Ropn1l Pre-designed siRNA Set B

Sign In for Pricing
View Details