Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU3 Spike glycoprotein (S), partial

This Recombinant Bat coronavirus HKU3 Spike glycoprotein (S), partial spans the amino acid sequence from region 310-514aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S glycoprotein, E2, Peplomer protein

UniProt

Q3LZX1

Expression Region

310-514aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RVSPTQEVIRFPNITNRCPFDKVFNATRFPNVYAWERTKISDCVADYTVLYNSTSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTGCVIAWNTAKHDTGNYYYRSHRKTKLKPFERDLSSDDGNGVYTLSTYDFNPNVPVAYQATRVVVLSFELLNAPATVCGPKLSTELVKNQCVNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SLC34A2 Antibody Picoband®, HRP Conjugate
A03957-1-HRP 100 µg/Vial

Anti-SLC34A2 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
pCMV-MIR320A-SV40-Neo Plasmid
PVT44823 2 µg

pCMV-MIR320A-SV40-Neo Plasmid

Sign In for Pricing
View Details
Innovative Grade US Origin Bovine Bone Fibula Fresh in Saline
IGBOBFIS 1 Each

Innovative Grade US Origin Bovine Bone Fibula Fresh in Saline

Sign In for Pricing
View Details
MORC2 Antibody, HRP conjugated
CSB-PA896555LB01HU-01 50 µg

MORC2 Antibody, HRP conjugated

Sign In for Pricing
View Details
MORC2 Antibody, HRP conjugated
CSB-PA896555LB01HU-02 100 µg

MORC2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Septin 2 Conjugated Antibody
orb1611285 100 µL

Septin 2 Conjugated Antibody

Sign In for Pricing
View Details