Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus 229E Nucleoprotein (N)

This Recombinant Human coronavirus 229E Nucleoprotein (N) spans the amino acid sequence from region 1-389aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein, NC, Protein N

UniProt

P15130

Expression Region

1-389aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Human coronavirus 229E (HCoV-229E)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Agxt sgRNA CRISPR Lentivector set (Mouse)
K3406401 3x 1.0 µg

Agxt sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Monoclonal CD3 epsilon Antibody (500A2) [DyLight 550]
NBP2-52643R 0.1 mL

Rabbit Monoclonal CD3 epsilon Antibody (500A2) [DyLight 550]

Sign In for Pricing
View Details
Arganine B
TN6438 5 mg

Arganine B

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS501542 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
PAK1, Phosphorylated (Thr212) (Serine/Threonine-protein Kinase PAK 1, p21-activated Kinase 1, PAK-1, p65-PAK, Alpha-PAK) (MaxLight 550)
MBS6491775-01 0.1 mL

PAK1, Phosphorylated (Thr212) (Serine/Threonine-protein Kinase PAK 1, p21-activated Kinase 1, PAK-1, p65-PAK, Alpha-PAK) (MaxLight 550)

Sign In for Pricing
View Details
PAK1, Phosphorylated (Thr212) (Serine/Threonine-protein Kinase PAK 1, p21-activated Kinase 1, PAK-1, p65-PAK, Alpha-PAK) (MaxLight 550)
MBS6491775-02 5x 0.1 mL

PAK1, Phosphorylated (Thr212) (Serine/Threonine-protein Kinase PAK 1, p21-activated Kinase 1, PAK-1, p65-PAK, Alpha-PAK) (MaxLight 550)

Sign In for Pricing
View Details