Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Severe acute respiratory syndrome coronavirus Replicase 1AB polyprotein, partial

This Recombinant Severe acute respiratory syndrome coronavirus 3C-like proteinase, partial spans the amino acid sequence from region 3547-3836aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Growth factor-like peptide, Leader protein, Non-structural protein 10, Non-structural protein 2, Non-structural protein 3, Non-structural protein 4, Non-structural protein 6, Non-structural protein 7, Non-structural protein 8, Non-structural protein 9, Papain-like proteinase, p65 homolog

UniProt

C8YZ74

Expression Region

3547-3836aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Severe acute respiratory syndrome coronavirus (SARS-CoV)

Field of Research

Respiratory Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-500 1x 500 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-100 1x 100 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF594 conjugate, 0.1mg/mL
BNC942559-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/8 (C-50), CF594 conjugate, 0.1mg/mL
BNC940948-100 1x 100 µL

Cytokeratin 5/8 (C-50), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details