Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial

This Recombinant Human coronavirus HKU1 Spike glycoprotein (S), partial spans the amino acid sequence from region 310-622aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E2, Peplomer protein

UniProt

Q0ZME7

Expression Region

310-622aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human coronavirus HKU1 (isolate N5) (HCoV-HKU1)

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVKPVATVYRRIPNLPDCDIDNWLNNVSVPSPLNWERRIFSNCNFNLSTLLRLVHVDSFSCNNLDKSKIFGSCFNSITVDKFAIPNRRRDDLQLGSSGFLQSSNYKIDISSSSCQLYYSLPLVNVTINNFNPSSWNRRYGFGSFNLSSYDVVYSDHCFSVNSDFCPCADPSVVNSCAKSKPPSAICPAGTKYRHCDLDTTLYVKNWCRCSCLPDPISTYSPNTCPQKKVVVGIGEHCPGLGINEEKCGTQLNHSSCFCSPDAFLGWSFDSCISNNRCNIFSNFIFNGINSGTTCSNDLLYSNTEISTGVCVNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL37AP6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV780971 1.0 µg DNA

RPL37AP6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TAL1 (T-cell Acute Lymphocytic Leukemia Protein 1) discontinued
376813 500 µg

TAL1 (T-cell Acute Lymphocytic Leukemia Protein 1) discontinued

Sign In for Pricing
View Details
C17orf12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0315807 1.0 µg DNA

C17orf12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Phospho-Akt1 (Ser124) Colorimetric Cell-Based ELISA Kit
MBS9501050-01 1 Kit

Phospho-Akt1 (Ser124) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Phospho-Akt1 (Ser124) Colorimetric Cell-Based ELISA Kit
MBS9501050-02 5x 1 Kit

Phospho-Akt1 (Ser124) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
IgG, H&L (Biotin)
I1904-40E 1 mg

IgG, H&L (Biotin)

Sign In for Pricing
View Details