Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa (5a)

This Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa (5a) spans the amino acid sequence from region 1-109aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ns12.7, 12.7 kDa accessory protein

UniProt

Q9QAQ5

Expression Region

1-109aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDIWKPETKYLRYTNGFNVSDLEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVYG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc120 Mouse qPCR Primer Pair (NM_207202)
MP202687 200 Reactions

Ccdc120 Mouse qPCR Primer Pair (NM_207202)

Sign In for Pricing
View Details
Slit Homolog 3 (Slit3) Magnetic Luminex Assay Kit
LKU601078 96 Tests

Slit Homolog 3 (Slit3) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Rabbit Anti-Mouse UBN2 pAb
PA5118-01 50 μL

Rabbit Anti-Mouse UBN2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Mouse UBN2 pAb
PA5118-02 100 μL

Rabbit Anti-Mouse UBN2 pAb

Sign In for Pricing
View Details
Fibrillarin antibody
70R-1360 100 µL

Fibrillarin antibody

Sign In for Pricing
View Details
Rat Krebs von den Lungen-6 (KL-6) ELISA Kit
orb1994860-01 48 Tests

Rat Krebs von den Lungen-6 (KL-6) ELISA Kit

Sign In for Pricing
View Details