Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)
This Recombinant Human coronavirus HKU1 Non-structural protein 4 (4) spans the amino acid sequence from region 1-109aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Accessory protein 4 Non-structural protein of 12.5 kDa Orf4 protein
UniProt
Q5MQC9
Expression Region
1-109aa
Tag
C-terminal 6xHis-tagged
Source
Baculovirus
Origin
Human coronavirus HKU1 (isolate N1) (HCoV-HKU1)
Field of Research
Epigenetics, Non-Animal
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
13.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MDVWRPSYTHSLVIREFGVTNLEDLCLKYNYCQPIVGYCIVPLNVWCRKFGKFASHFTLRSHDISHSNNFGVVTSFTTYGNTVSEAVSRLVESASEFIVWRAEALNKYG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
030843 100 µL
CD25 (IL2RA, Interleukin-2 receptor subunit alpha, TAC antigen, p55, CD_antigen=CD25)
Sign In for Pricing
View Details 
LV743188 1.0 µg DNA
RN5S66 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details MPX3321K Each
Magic™ Membrane Protein Human OR8A1 (Olfactory receptor family 8 subfamily A member 1) Expressed in vitro E.coli expression system, Full Length
Sign In for Pricing
View Details