Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU3 Spike glycoprotein (S), partial

This Recombinant Bat coronavirus HKU3 Spike glycoprotein (S), partial spans the amino acid sequence from region 310-514aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(S glycoprotein) (E2) (Peplomer protein)

UniProt

Q3LZX1

Expression Region

310-514aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bat coronavirus HKU3 (BtCoV) (SARS-like coronavirus HKU3)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0

AA Sequence

RVSPTQEVIRFPNITNRCPFDKVFNATRFPNVYAWERTKISDCVADYTVLYNSTSFSTFKCYGVSPSKLIDLCFTSVYADTFLIRSSEVRQVAPGETGVIADYNYKLPDDFTGCVIAWNTAKHDTGNYYYRSHRKTKLKPFERDLSSDDGNGVYTLSTYDFNPNVPVAYQATRVVVLSFELLNAPATVCGPKLSTELVKNQCVNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ddr2 3'UTR Lenti-reporter-Luc Vector
17786086 1.0 µg

Ddr2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
GALR2 Polyclonal Antibody
E-AB-17985-01 20 µL

GALR2 Polyclonal Antibody

Sign In for Pricing
View Details
GALR2 Polyclonal Antibody
E-AB-17985-02 60 µL

GALR2 Polyclonal Antibody

Sign In for Pricing
View Details
GALR2 Polyclonal Antibody
E-AB-17985-03 120 µL

GALR2 Polyclonal Antibody

Sign In for Pricing
View Details
GALR2 Polyclonal Antibody
E-AB-17985-04 200 µL

GALR2 Polyclonal Antibody

Sign In for Pricing
View Details
HVCN1 Antibody
MBS151000-01 0.1 mg

HVCN1 Antibody

Sign In for Pricing
View Details