Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proteoglycan 4 (PRG4), partial

This Recombinant Human Proteoglycan 4 (PRG4), partial spans the amino acid sequence from region 25-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lubricin (Megakaryocyte-stimulating factor) (Superficial zone proteoglycan) (MSF) (SZP)

UniProt

Q92954

Expression Region

25-156aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Coiled-coil domain-containing protein 144A (CCDC144A) ELISA Kit
MBS7238685-01 48 Well

Rabbit Coiled-coil domain-containing protein 144A (CCDC144A) ELISA Kit

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 144A (CCDC144A) ELISA Kit
MBS7238685-02 96 Well

Rabbit Coiled-coil domain-containing protein 144A (CCDC144A) ELISA Kit

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 144A (CCDC144A) ELISA Kit
MBS7238685-03 5x 96 Well

Rabbit Coiled-coil domain-containing protein 144A (CCDC144A) ELISA Kit

Sign In for Pricing
View Details
Rabbit Coiled-coil domain-containing protein 144A (CCDC144A) ELISA Kit
MBS7238685-04 10x 96 Well

Rabbit Coiled-coil domain-containing protein 144A (CCDC144A) ELISA Kit

Sign In for Pricing
View Details
Nerve Growth Factor 2.5S (Beta-Nerve Growth Factor, Beta-NGF, Ngf, Ngfb) (MaxLight 490) discontinued
N2050-04D-ML490 100 µL

Nerve Growth Factor 2.5S (Beta-Nerve Growth Factor, Beta-NGF, Ngf, Ngfb) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Clostridium Phytofermentans rpmA Protein (aa 1-95)
VAng-Lsx01428-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Phytofermentans rpmA Protein (aa 1-95)

Sign In for Pricing
View Details