Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proteoglycan 4 (PRG4), partial

This Recombinant Human Proteoglycan 4 (PRG4), partial spans the amino acid sequence from region 25-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lubricin (Megakaryocyte-stimulating factor) (Superficial zone proteoglycan) (MSF) (SZP)

UniProt

Q92954

Expression Region

25-156aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy PDZ and LIM Domain Protein 1 ELISA Kit
MBS085503 Inquire

Cavy PDZ and LIM Domain Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human NDUFA1 pAb
PA16473-01 50 μL

Rabbit Anti-Human NDUFA1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human NDUFA1 pAb
PA16473-02 100 μL

Rabbit Anti-Human NDUFA1 pAb

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 espF(U) Polyclonal Antibody
MBS9004064 Inquire

Rabbit anti-Escherichia coli O157:H7 espF(U) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Angiopoietin-like Protein 3/ANGPTL3 (C-6His)
CU43-500ug 500 µg

Recombinant Human Angiopoietin-like Protein 3/ANGPTL3 (C-6His)

Sign In for Pricing
View Details
Anti-Desmocollin 2 antibody
PAab02344 100 µg

Anti-Desmocollin 2 antibody

Sign In for Pricing
View Details