Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hexokinase-1 (HK1), partial

This Recombinant Human Hexokinase-1 (HK1), partial spans the amino acid sequence from region 476-917aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Brain form hexokinaseHexokinase type I , HK I

UniProt

P19367

Expression Region

476-917aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ptger4 (NM_008965) AAV Particle
MR226174A1V 250 µL

Mouse Ptger4 (NM_008965) AAV Particle

Sign In for Pricing
View Details
ZGPAT 3'UTR GFP Stable Cell Line
TU078878 1.0 mL

ZGPAT 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Factor I (CFI) Human Over-expression Lysate
orb1341633 100 µg

Factor I (CFI) Human Over-expression Lysate

Sign In for Pricing
View Details
SDCCAG8 Peptide - middle region (AAP52216)
AAP52216-100UG 100 µg

SDCCAG8 Peptide - middle region (AAP52216)

Sign In for Pricing
View Details
Rabbit anti-Haemophilus influenzae (strain 51907/DSM 11121/KW20/Rd) DPRA Polyclonal Antibody
MBS7157832 Inquire

Rabbit anti-Haemophilus influenzae (strain 51907/DSM 11121/KW20/Rd) DPRA Polyclonal Antibody

Sign In for Pricing
View Details
HOXD9 Human siRNA Oligo Duplex (Locus ID 3235)
SR302212 1 Kit

HOXD9 Human siRNA Oligo Duplex (Locus ID 3235)

Sign In for Pricing
View Details